Protein Info for B158DRAFT_2132 in Kangiella aquimarina DSM 16071

Annotation: mutator mutT protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00586: mutator mutT protein
  • amino acids 4 to 127 (124 residues), 98.1 bits, E=1.9e-32
• PF00293: NUDIX
  • amino acids 6 to 112 (107 residues), 51.8 bits, E=9.1e-18
• PF14815: NUDIX_4
  • amino acids 8 to 124 (117 residues), 82.7 bits, E=1.8e-27

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 82% identity to kko:Kkor_0699)

Predicted SEED Role

"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (128 amino acids)

>B158DRAFT_2132 mutator mutT protein (Kangiella aquimarina DSM 16071)
MSNTIRVAVAVIQRRDRILIAKRPQHLHKGGFWEFPGGKQENDEPISQALIRECFEELAI
IPVKFSPLIQIEHTYPEKSVFLDVWTVTDYMGVPRGVEGQPLVWCPVKQLDEYQFPEANL
AIVEAIRR