Protein Info for B158DRAFT_2128 in Kangiella aquimarina DSM 16071

Annotation: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR00325: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase" amino acids 2 to 296 (295 residues), 410.7 bits, see alignment E=1.8e-127 PF03331: LpxC" amino acids 4 to 275 (272 residues), 373.6 bits, see alignment E=3.1e-116

Best Hits

Swiss-Prot: 76% identical to LPXC_AZOVD: UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 99% identity to kko:Kkor_0695)

MetaCyc: 61% identical to UDP-3-O-acyl-N-acetylglucosamine deacetylase (Escherichia coli K-12 substr. MG1655)
UDPACYLGLCNACDEACETYL-RXN [EC: 3.5.1.108]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)" (EC 3.5.1.108)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>B158DRAFT_2128 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108) (Kangiella aquimarina DSM 16071)
MIRQRTLKTTIRATGVGLHTGEKVYLTLRPAPVDTGIVFRRVDLDPIVEIEAKPENVGDT
TLSTCLVKDDVRISTVEHLLSAMAGLGLDNAYIDVSAPEVPIMDGSASPFVFLLQSAGIT
EQNAPKKFIKIKKRVEVEDEGKTAVFEPFDGFKVAFTIDFDHPVFKKSRQTAVIDFSSTS
FVKEVSRARTFGFMKDIEYLRSHNLALGGSQDNAIVMDDFRVLNEDGLRYDDEFVKHKIL
DAIGDLFLLGHSLIGAFSGYKSGHALNNKLIRTLMADETAWELATYEDANAAPISYIMNP
ALSV