Protein Info for B158DRAFT_2124 in Kangiella aquimarina DSM 16071

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 8 to 306 (299 residues), 326.8 bits, E=6.1e-102
• PF01820: Dala_Dala_lig_N
  • amino acids 55 to 90 (36 residues), 35.1 bits, 2.6e-12
• PF02786: CPSase_L_D2
  • amino acids 100 to 275 (176 residues), 25.4 bits, E=1.4e-09
• PF07478: Dala_Dala_lig_C
  • amino acids 107 to 304 (198 residues), 180.6 bits, E=4.2e-57

Best Hits

Swiss-Prot: 53% identical to DDL_PSEA6: D-alanine--D-alanine ligase (ddl) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 88% identity to kko:Kkor_0691)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Protein Sequence (312 amino acids)

>B158DRAFT_2124 D-alanine--D-alanine ligase (Kangiella aquimarina DSM 16071)
MSIDKFGKVAVLYGGHSAERDVSLRSGKAVHNALQTVGIDAVLIDPKTDGLEAIQNSQCD
RVWNALHGRGGEDGVIQAHLQLLGLPYTGSGVMASAIAMDKLRTKLIWQAMGYPVAKHRM
LNTGVLSLDQTADVLADMSGCVMVKPIREGSSVGMAKADDAETLVKAVNSAKQYDREVML
EQWIDGDEYTVSILNGKALSSIRVKTPNTFYDFQAKYQSNTTEYLCPSGLNAEDEAELAE
LSQAAFYALGCEGWGRVDLMRERSSGNWYLLEVNTVPGMTETSLVPKAAKQSGMSFEELV
VAVLETSFVERH