Protein Info for B158DRAFT_2113 in Kangiella aquimarina DSM 16071

Annotation: mraZ protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF02381: MraZ" amino acids 1 to 75 (75 residues), 62.8 bits, see alignment E=1.2e-21 amino acids 77 to 134 (58 residues), 61.8 bits, see alignment E=2.4e-21 TIGR00242: division/cell wall cluster transcriptional repressor MraZ" amino acids 1 to 136 (136 residues), 159.2 bits, see alignment E=3.2e-51

Best Hits

Swiss-Prot: 49% identical to MRAZ_ECO27: Transcriptional regulator MraZ (mraZ) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K03925, MraZ protein (inferred from 97% identity to kko:Kkor_0680)

Predicted SEED Role

"Cell division protein MraZ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>B158DRAFT_2113 mraZ protein (Kangiella aquimarina DSM 16071)
MFRGATAINMDAKGRIAIPAKYRSRFEDVCSNQIVVTIDLFDPCLLLFPLPHWEQLEAKL
DTFSNTDPNQRRIKRMLLGHASEHEIDGNGRILLPPVLREYAQLEKQLLLAGQGKTFQIW
NEENWHKKIEQDVEALAEGPLDPESLPELAF