Protein Info for B158DRAFT_2106 in Kangiella aquimarina DSM 16071

Annotation: Phosphoheptose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 14 to 144 (131 residues), 108.5 bits, E=2.8e-35
• PF01380: SIS
  • amino acids 89 to 154 (66 residues), 27 bits, E=3.6e-10

Best Hits

Swiss-Prot: 76% identical to GMHA_SHELP: Phosphoheptose isomerase (gmhA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K12961, DnaA initiator-associating protein (inferred from 97% identity to kko:Kkor_0673)

MetaCyc: 46% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (3/5 steps found)
• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.- or 5.3.1.28

Protein Sequence (195 amino acids)

>B158DRAFT_2106 Phosphoheptose isomerase (Kangiella aquimarina DSM 16071)
MIERIRDIFTESIQTKIAAADALPESIEKAGQIMVNSLLNGHKILSCGNGGSAGDAQHFS
SEMLNRFERERPSLPAIALTTDTGTLTSISNDYSYNDVFAKQLRALGQPGDVLLAISTSG
NSRNVINAMETALSKDMLIVALTGKDGGEMAGLMGPNDIEIRVPSNSTARIQEVHLVVIH
ALCDFIDNSLFGTEV