Protein Info for B158DRAFT_2095 in Kangiella aquimarina DSM 16071

Annotation: Predicted ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF03969: AFG1_ATPase" amino acids 7 to 364 (358 residues), 482.2 bits, see alignment E=4.7e-149

Best Hits

Swiss-Prot: 56% identical to ZAPE_ECOLI: Cell division protein ZapE (zapE) from Escherichia coli (strain K12)

KEGG orthology group: K06916, (no description) (inferred from 92% identity to kko:Kkor_0662)

Predicted SEED Role

"ATPase, AFG1 family" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>B158DRAFT_2095 Predicted ATPase (Kangiella aquimarina DSM 16071)
MRTIDLTPKQKYEQDLASGFAKDPAQAEAVAALQRVYDDLLDSRPSGGFMDLVKRLLSSD
LDPVKGLYMWGGVGRGKTWLMDTFFNCLPIKGKIRLHFHRFMHEVHHELKALAGEKNPLI
KIADQLSQRARVICFDEFFVTDITDAMILGGLFKELFERNIVLVATSNIPPERLYWNGLQ
RERFLPAIELIQKHCQVLNVDGGTDYRLRTLEKAEIYHYPLDAAADSNMKQYFLQLSGEE
GQQHCKLKVEGRLIDAVRLSDNVVWFTFDAICKTERSANDYIELSRNYHTVFVSKIPKLD
DSVNDATRRFIALVDEFYERHVKLILSAEVALEELYVGKGLAFEFKRTVSRLQEMQSKEY
LAKEHLA