Protein Info for B158DRAFT_2090 in Kangiella aquimarina DSM 16071

Annotation: Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details PF00089: Trypsin" amino acids 101 to 258 (158 residues), 50.5 bits, see alignment E=6.1e-17 PF13365: Trypsin_2" amino acids 106 to 236 (131 residues), 108.3 bits, see alignment E=1.5e-34 PF00595: PDZ" amino acids 311 to 370 (60 residues), 38.3 bits, see alignment E=3.7e-13 PF13180: PDZ_2" amino acids 317 to 383 (67 residues), 62.4 bits, see alignment E=1e-20 PF17820: PDZ_6" amino acids 319 to 358 (40 residues), 35.3 bits, see alignment 2.1e-12

Best Hits

KEGG orthology group: K04691, serine protease DegS [EC: 3.4.21.-] (inferred from 77% identity to kko:Kkor_0657)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>B158DRAFT_2090 Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain (Kangiella aquimarina DSM 16071)
MQFLTYIGYIIKYLLVGLGIAALFIVFMPGRFSINSPSEQTTDSTVQVPQQVVPFSGYAD
MLDKARPAVVSIQARSKLYPLNDPECQNSLRAIPSGTNACAFLNNGSGVFIDEQGHIVTN
AHVLDKAESIIVELLNGQKLAATVIGLDKDSDLALLKVDYQPQHILSLGQEDKSRVGDIV
FAIGTPYMAFEQTVTQGIISAKFFSRVSHYIQTDAALRSGNSGGALVNSQGELVGITALS
SRDESGEKTYQNFAIAAADVQHVVNELLENGVVQRGWLGLNGDMTINFRSIVQEMNLPLP
QQQLLASQIEQLPFGQGIVITAVNGNGPADKAGLQALDIITEVNGKPINSTADLMAAIWN
VAPETEIQLEYYRDGQKNQAEVILGYRD