Protein Info for B158DRAFT_2086 in Kangiella aquimarina DSM 16071

Annotation: K+-dependent Na+/Ca+ exchanger related-protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 23 (1 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 112 to 128 (17 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 183 to 208 (26 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 3 to 321 (319 residues), 254.2 bits, see alignment E=7.9e-80 PF01699: Na_Ca_ex" amino acids 5 to 151 (147 residues), 96.6 bits, see alignment E=7.3e-32 amino acids 182 to 325 (144 residues), 120.1 bits, see alignment E=4.1e-39

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 91% identity to kko:Kkor_0654)

Predicted SEED Role

"Inner membrane protein YrbG, predicted calcium/sodium:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>B158DRAFT_2086 K+-dependent Na+/Ca+ exchanger related-protein (Kangiella aquimarina DSM 16071)
MIEHIAYILVGITLLVWSADRFTDGAAAVAQNFGVSRLIVGLTIVAIGSSAPEIFVSILD
SFKTCAPDVENCGPEVAIGNAIGSNITNVALVLGITALVKPLLINSGMIKREIPILFVVS
FAVLYFFWDLRLSHIEGMILLSSLVAYFIWLVHMGIKSRASNDRMLEEIVDELPEQMSSP
KAIFWLFLGLVLLVVSSKILIVGASGFALQMGVSETLIGLTIVALGTSLPELAASISAVL
KNEHEIAIGNVVGSNIFNLLGVLGIPAVIAAPMVEKEILTIDYPVMFGLCILLAVLAYGI
RGPGKINRLAGAILLAAFIGYYIVRVF