Protein Info for B158DRAFT_2082 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03968: LptD_N" amino acids 32 to 121 (90 residues), 33.9 bits, see alignment E=4.9e-12 amino acids 96 to 208 (113 residues), 29.5 bits, see alignment E=1.2e-10 amino acids 168 to 216 (49 residues), 20.5 bits, see alignment 7e-08

Best Hits

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 84% identity to kko:Kkor_0650)

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>B158DRAFT_2082 Uncharacterized protein conserved in bacteria (Kangiella aquimarina DSM 16071)
MKFRLLIAALILSSLSSGSLVQAATLEKSRLRSDRSNLDVQNNIIIYRDNVIYEHGNMTI
YADSLTKQGENAGTITALGSPVKIHYVDETGETTDIDAPKIIYRQQSGELSASGDIKIVQ
SSGIDKLTLLGNQLTANQGVTEGFGFVLNGAPTEFRIEQPSQPAIYATADQLRSNGKDKQ
TELVGNVKLQQGDSNMTAAFLTYDGTSKVISAGKSDSGEQRVETEFFWEQEQGDNATSSQ
SATEQQTEKEQQQ