Protein Info for B158DRAFT_2078 in Kangiella aquimarina DSM 16071

Annotation: PTS IIA-like nitrogen-regulatory protein PtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00359: PTS_EIIA_2
  • amino acids 7 to 148 (142 residues), 111 bits, E=2.5e-36

Best Hits

Swiss-Prot: 34% identical to PTSN_PSEAE: Nitrogen regulatory protein (ptsN) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 79% identity to kko:Kkor_0646)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (182 amino acids)

>B158DRAFT_2078 PTS IIA-like nitrogen-regulatory protein PtsN (Kangiella aquimarina DSM 16071)
MHIEDVIAPELCVLGAQATSRKKALQFIATLFAEHNSQYEPFLLLKALVAREQMGTTAIG
NGVALPHGRVESCEEPLAVFVTLAEPIDFDAPDQEPVDIVFALIVPKQFDFQQLNGLDGL
IEILKDKKVCAQIRHAHNNQALYEIIESAIAQHEKAQGLERVSIERANKEKSKEKKEIED
NT