Protein Info for B158DRAFT_2077 in Kangiella aquimarina DSM 16071

Annotation: Predicted P-loop-containing kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF03668: ATP_bind_2" amino acids 1 to 282 (282 residues), 327.2 bits, see alignment E=4.5e-102

Best Hits

Swiss-Prot: 50% identical to Y4546_COLP3: Nucleotide-binding protein CPS_4546 (CPS_4546) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 94% identity to kko:Kkor_0645)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>B158DRAFT_2077 Predicted P-loop-containing kinase (Kangiella aquimarina DSM 16071)
MKLLIVSGRSGSGKSVALKALEDMGYYCIDNLPLSLTLNVIDDHILRNEDIAIGVDARNR
HDLEHFSEEITRIKKEAPQAKTLFLDADETTLLKRFSETRRRHPLTNRGLSLRDAIKEEK
KLLEPVRASADLVVNTSELSPHELRERLRERVSGDKSQSMDIRLVSFGFKHGAPKDADFV
FDVRCLPNPYWDPELRDFTGKDPQIQHFLEQSSMVMEYTWQLKVFFSTWIPEFSKQDRSY
FTCAIGCTGGRHRSVFMVETLAKALKPLYPNISIEHRQLDKKQ