Protein Info for B158DRAFT_2076 in Kangiella aquimarina DSM 16071

Annotation: Mg2+ transporter (mgtE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 289 to 309 (21 residues), see Phobius details amino acids 317 to 342 (26 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 397 to 423 (27 residues), see Phobius details amino acids 432 to 458 (27 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 20 to 457 (438 residues), 284 bits, see alignment E=1e-88 PF03448: MgtE_N" amino acids 37 to 137 (101 residues), 97.9 bits, see alignment E=7e-32 PF00571: CBS" amino acids 205 to 258 (54 residues), 35.7 bits, see alignment 1.3e-12 PF01769: MgtE" amino acids 324 to 453 (130 residues), 101.7 bits, see alignment E=5.3e-33

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 98% identity to kko:Kkor_0644)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>B158DRAFT_2076 Mg2+ transporter (mgtE) (Kangiella aquimarina DSM 16071)
MAETQATQTRQEQLQLLNNALDSGHLIPVRNLLEELRSADIAHLLESTPPRVRNVIWQLL
DKEREGDVLQHLNDEIRQSFIEQMQPQELANALADLDTDDVVDILGDLSQNISNQVLRLL
DEQNRAQIEHALSYPEDSAGGLMNIDTIMIRPRVSVEVVLRYLRIRGNMPPNTDHLYVVD
SRDVLIGSVPISSILTCDPDTPITQIVDKETFTIPVDMPETEVAQIFERHDLVSAPVLDE
NGRLLGRITIDDVVDVIREEADHSLMSMAGLDELEDTFGKVAATAKKRAIWLGINLLTVI
LAALVIGLFENTIAQVTLLAVLLPIVPSMGGIAGTQTLTLVIRGMSLGHIGEGNKGYLLK
KELAVSIINGVLWALVIAALVYGYSYYKDSGINHLHLAITIGGAMLFNLVTGVVSGAVLP
LFLKKINIDPAIAGGVVLTTVTDVAGFFALLGLATLFFA