Protein Info for B158DRAFT_2075 in Kangiella aquimarina DSM 16071

Annotation: microcin-processing peptidase 1. Unknown type peptidase. MEROPS family U62

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF01523: PmbA_TldD_1st" amino acids 48 to 106 (59 residues), 40.3 bits, see alignment E=4.4e-14 PF19290: PmbA_TldD_2nd" amino acids 134 to 239 (106 residues), 54.9 bits, see alignment E=1.8e-18 PF19289: PmbA_TldD_3rd" amino acids 246 to 453 (208 residues), 218.6 bits, see alignment E=8.9e-69

Best Hits

Swiss-Prot: 45% identical to PMBA_ECOLI: Metalloprotease PmbA (pmbA) from Escherichia coli (strain K12)

KEGG orthology group: K03592, PmbA protein (inferred from 88% identity to kko:Kkor_0643)

MetaCyc: 45% identical to metalloprotease subunit TldE (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>B158DRAFT_2075 microcin-processing peptidase 1. Unknown type peptidase. MEROPS family U62 (Kangiella aquimarina DSM 16071)
MASDKHLTLTQIAEQQAATEQQLRLMVQVALQQAAEAGAEQSEIWCYNTVGNSIEVRQGE
LETLEFNQDSHFGINVYFGQRKGTVSINDLTEAAVHKGVQAACEIASFTEPDPYSGLADK
MLMATEFKDLQLDHPNDLTIPHMVESARQCEAKALTDSRIKQSEGASSYSHRSVSLYANS
HGFIGTNHTTRFSLSNSVIAETDNGMIRDGYYTIGRDVADLLPPETVGEQAASRVLNKLV
QGKVPSGNHPVIFSAELARGLWSHMLSALKGAALYQRASFLLDKKEQLILPEFVQIEEDP
FIVKGFGSGNYDSDGVATRKRDIVVDGVLKDYFLSSYSARRLGLQTTGNAGGIHNVLVKP
MDLSLQEMMKQLGSGLLLTEVMGQGVNTVTGNYSRGASGYWFENGEIKHFAQELTIAGNL
EQMLKNIVAISNDVDLRSSILTGSVAIEGMMVAS