Protein Info for B158DRAFT_2067 in Kangiella aquimarina DSM 16071

Annotation: rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details PF04093: MreD" amino acids 10 to 156 (147 residues), 102.7 bits, see alignment E=1.1e-33 TIGR03426: rod shape-determining protein MreD" amino acids 12 to 156 (145 residues), 119.1 bits, see alignment E=8.5e-39

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 86% identity to kko:Kkor_0635)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>B158DRAFT_2067 rod shape-determining protein MreD (Kangiella aquimarina DSM 16071)
MKTMTNETKHGTWIIILSLIIGMVLDIFPLPESWQSFRPSFTFLVLAYWIIALPHRIGLL
WAFITGLALDALLGTTLGLHSFALAILTFILQLNHQRLRLFPLWKQAFTMVFLSIIYFAV
VLWLARLTGKPESNIWYWLATITNGILWPWLFVLLRDIRRYFHVV