Protein Info for B158DRAFT_2054 in Kangiella aquimarina DSM 16071

Annotation: ribosomal protein L25, Ctc-form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF01386: Ribosomal_L25p" amino acids 7 to 94 (88 residues), 92.1 bits, see alignment E=2.4e-30 TIGR00731: ribosomal protein bL25, Ctc-form" amino acids 8 to 173 (166 residues), 147.2 bits, see alignment E=2e-47 PF14693: Ribosomal_TL5_C" amino acids 104 to 190 (87 residues), 96.8 bits, see alignment E=7.7e-32

Best Hits

Swiss-Prot: 50% identical to RL25_IDILO: 50S ribosomal protein L25 (rplY) from Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

KEGG orthology group: K02897, large subunit ribosomal protein L25 (inferred from 87% identity to kko:Kkor_0625)

Predicted SEED Role

"LSU ribosomal protein L25p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>B158DRAFT_2054 ribosomal protein L25, Ctc-form (Kangiella aquimarina DSM 16071)
MSEFTFNAELRSDMGKGASRRLRREADMIPAIVYGGKEEPKSISLNHNQIINMLDEEAVY
SSIINLDIDGTVEEVVIKDIQRHPFKPKVLHMDLKRIVRGEIMNATVPLHFLNEKSAPGV
KAGGVMSHQITSVEVACRPRNLPEYIEVDLGGLDLGDTIHLSDLKLPEGVELTALQGEEH
DLSVANVVRPSGPSEDETEEADEAAEAEVPATEQKGDEEAGEDKE