Protein Info for B158DRAFT_2042 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized paraquat-inducible protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF12242: Eno-Rase_NADH_b" amino acids 2 to 82 (81 residues), 122.2 bits, see alignment E=9.1e-40 PF12241: Enoyl_reductase" amino acids 84 to 320 (237 residues), 357.4 bits, see alignment E=4.8e-111 PF07055: Eno-Rase_FAD_bd" amino acids 327 to 389 (63 residues), 89.6 bits, see alignment E=2.1e-29

Best Hits

Swiss-Prot: 64% identical to FABV_TERTT: Enoyl-[acyl-carrier-protein] reductase [NADH] (fabV) from Teredinibacter turnerae (strain ATCC 39867 / T7901)

KEGG orthology group: None (inferred from 95% identity to kko:Kkor_0610)

Predicted SEED Role

"Uncharacterized paraquat-inducible protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>B158DRAFT_2042 Uncharacterized paraquat-inducible protein B (Kangiella aquimarina DSM 16071)
MVIKPKVRGFVCTTAHPHGCVAHVNEQIEYVKNNMPADAEAGPKNVLVIGSSTGYGLASR
IVSAFGYGAKTLGLFFEKEPTESKPGTAGWYNNRGFEMAADKAGLWNKSINGDAFSNQAK
EDAIKIIKEEMGKIDTVIYSLASPRRQDPETGEVYKSVLKPIGEAVTEKTLNTDKGIVHD
VSIEPATDDDIQNTIKVMGGEDWELWMKALDEAGVLADGVKTVAYTYIGKKLTWPIYGHA
TIGKAKEDLDRASHAIHDMLQNKYNGTANVAVLKAVVTQASSAIPVMPLYISLLYKVMKE
NDVHEDPIHQIKGLIMDQMYGDDAIYDDTRRYRLDLKELDDAIQNKVEELWQIATTENIN
EISDYKGYQHEFFKLFGFEVDGVDYDADVDPRI