Protein Info for B158DRAFT_2033 in Kangiella aquimarina DSM 16071

Annotation: outer membrane transport energization protein TonB (TC 2.C.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03544: TonB_C
  • amino acids 122 to 200 (79 residues), 77.6 bits, E=4.3e-26
• TIGR01352: TonB family C-terminal domain
  • amino acids 123 to 200 (78 residues), 62.3 bits, E=2.2e-21

Best Hits

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 82% identity to kko:Kkor_0600)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Protein Sequence (204 amino acids)

>B158DRAFT_2033 outer membrane transport energization protein TonB (TC 2.C.1.1.1) (Kangiella aquimarina DSM 16071)
MKIFTAGFIGLIVTGVLLLLMSQLINSDHQVVEKQKVVTLVDTPLPPEKQPKTNRLPKPQ
PPAVAPSAGEAVPLRASTIDTPDIPTVDFEPVDVSYQAPIIGAPAPHELLDSRSALPLFQ
AQPNYPIIAASQGIEGWVLLQYDVDTSGTLSNINVLDAQPRRTFDKEAVAALKKWKFRPA
MDNGQPISVKGQTVKIEFNLEQER