Protein Info for B158DRAFT_2027 in Kangiella aquimarina DSM 16071

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF07638: Sigma70_ECF" amino acids 8 to 173 (166 residues), 23 bits, see alignment E=1.3e-08 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 19 to 172 (154 residues), 106.7 bits, see alignment E=4.7e-35 PF04542: Sigma70_r2" amino acids 24 to 89 (66 residues), 60.8 bits, see alignment E=1.8e-20 PF08281: Sigma70_r4_2" amino acids 117 to 167 (51 residues), 54 bits, see alignment E=2.1e-18 PF04545: Sigma70_r4" amino acids 121 to 169 (49 residues), 33.7 bits, see alignment E=4.1e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 92% identity to kko:Kkor_0594)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>B158DRAFT_2027 RNA polymerase sigma factor, sigma-70 family (Kangiella aquimarina DSM 16071)
MDLDDENQLVALAKQGDMQAFEQLYRQFSNKIYLLCLRMTGRPALAEEHMQDAFIKAWQA
LGKFEGNSKFSTWVYRIAVNVVLNEQRKNHIEIHADQDWQQAFEDELSATHHPQQIDLEK
AIVKLPAQARNVLLLHDIMGMTHEEIGDTLGIASGTCKAHLSRARVLLKEQLER