Protein Info for B158DRAFT_1995 in Kangiella aquimarina DSM 16071

Annotation: Mn2+ and Fe2+ transporters of the NRAMP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 279 to 305 (27 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 343 to 366 (24 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details PF01566: Nramp" amino acids 27 to 377 (351 residues), 300 bits, see alignment E=1.2e-93

Best Hits

KEGG orthology group: None (inferred from 96% identity to kko:Kkor_0563)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>B158DRAFT_1995 Mn2+ and Fe2+ transporters of the NRAMP family (Kangiella aquimarina DSM 16071)
MTKRKFSFGPATLVTAAFIGPGTVTVATKAGASFGFVLLWALVFSVLATMILQEMTARLG
VVGRKGLGESIREQFTNPLARGVAVILVISAIVIGNAAYEGGNIAGATLGIDAVFGEWFL
AGSLNGWALLIGIIAFTLLWTGSYKLIERFLIAIVLLMSVSFLLTFIITKPDFSELFSGL
FIPTLPDGATLTVIALIGTTVVPYNLFLHASSAKKKWHDENDLPEARRDLLISIPLGGLI
TMAIISTAASAFFAKQIEINSAADMALSLEPLFGASAKYLMALGLFSAGITSAITAPLAS
AYALAGLMQLGNDMRSIKFRAVWISILITGVILASIGFKPISIIWFAQIANGILLPIVAI
FLLWTMNQSFLGKHKNSLLQNILGGLVVLVTLMLSARSLMSAFGLLN