Protein Info for B158DRAFT_1992 in Kangiella aquimarina DSM 16071

Annotation: biotin-dependent carboxylase uncharacterized domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00724: biotin-dependent carboxylase uncharacterized domain
  • amino acids 3 to 306 (304 residues), 274.4 bits, E=5.4e-86
• PF02626: CT_A_B
  • amino acids 25 to 285 (261 residues), 279.5 bits, E=1.6e-87

Best Hits

KEGG orthology group: None (inferred from 83% identity to kko:Kkor_0560)

Predicted SEED Role

"Allophanate hydrolase 2 subunit 2 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

• L-citrulline degradation (2/3 steps found)
• cyanate degradation (2/3 steps found)
• urea degradation I (2/3 steps found)
• cyanuric acid degradation II (3/5 steps found)
• uracil degradation III (3/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (2/4 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of allantoin degradation in yeast (2/6 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54

Protein Sequence (309 amino acids)

>B158DRAFT_1992 biotin-dependent carboxylase uncharacterized domain (Kangiella aquimarina DSM 16071)
MSINFIKAGLQTSLQDLGRPGFRRFGIPNNGALDPVSLQIANWLVSKPLNSACLEITQAG
PVIEFTQDMAIAVTGAHFELSIDDLPVDMHQTLLVNKGERLTFGKLVNGARAYLAFSAEP
DMPKIMESYSTNLMAQFGGYEGKALKNNDTIPLTNIVIPKTRKTPKGLQLQFSDNYQIRF
NEGREWSCFSKDMKQQFLQTAYQVTSQSNRMGMRLKGEAIKTEMPLSMTTVPITPGTIQI
PPDGQPIVTLADGQTTGGYPRIGQVITADLPILGQLKANDSISFQKIDVEDAIDLFKAKT
NLMKQLLGV