Protein Info for B158DRAFT_1984 in Kangiella aquimarina DSM 16071

Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF13489: Methyltransf_23" amino acids 17 to 137 (121 residues), 38.7 bits, see alignment E=2.6e-13 PF13847: Methyltransf_31" amino acids 38 to 136 (99 residues), 41.2 bits, see alignment E=4.3e-14 PF01209: Ubie_methyltran" amino acids 38 to 142 (105 residues), 43.6 bits, see alignment E=6.8e-15 PF08241: Methyltransf_11" amino acids 44 to 131 (88 residues), 75.8 bits, see alignment E=1e-24 PF08242: Methyltransf_12" amino acids 44 to 130 (87 residues), 40.2 bits, see alignment E=1.5e-13 PF13649: Methyltransf_25" amino acids 44 to 128 (85 residues), 65.2 bits, see alignment E=2.2e-21

Best Hits

Swiss-Prot: 32% identical to Y8948_DICDI: Putative methyltransferase DDB_G0268948 (DDB_G0268948) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 91% identity to kko:Kkor_0552)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>B158DRAFT_1984 Methylase involved in ubiquinone/menaquinone biosynthesis (Kangiella aquimarina DSM 16071)
MESVYKGFNFSSNAENYRRYRPDYPDDLFHYLAMLSDNHENAWDVATGNGQAAIGLAQHF
TKVYASDISTRQLENAHQRKNIKYFVGSAEQCKFPDESMDIITVAQALHWLDIEKFFSEA
KRILRPGGILAVWNYQLLEINLEVDAVIRHLYGHVLGDYWPMQRKTLENHFSEFQFPFQT
IPAPDFKVEKTWTFDQVIGYLNSWSATQNYIQQEQKNPISQLSQKLIFAWCDTNHMKKVR
WPIKLTVCRKPES