Protein Info for B158DRAFT_1983 in Kangiella aquimarina DSM 16071

Annotation: Protein of unknown function (DUF1282).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details PF04893: Yip1" amino acids 5 to 179 (175 residues), 103 bits, see alignment E=8.4e-34

Best Hits

KEGG orthology group: None (inferred from 91% identity to kko:Kkor_0551)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>B158DRAFT_1983 Protein of unknown function (DUF1282). (Kangiella aquimarina DSM 16071)
MKNRFNVLYNPAKAWEQLREENFSVKQAYIRMVIWMALLPPVFAFIGAVYSGWRIGYEEP
VKLTWQSALTISIAAYLAILVGLYIFARLVHWMAQTYDSNATVNDAFVLVAYSCMPLFLI
SITSAYPLLWLNTLLTLVAVALALRILFAGTPIMMGIDKDRGILFTNSILTVALVLIVAV
LAISVIFWANGMGPVFTR