Protein Info for B158DRAFT_1976 in Kangiella aquimarina DSM 16071

Annotation: argininosuccinate synthase (EC 6.3.4.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00764: Arginosuc_synth
  • amino acids 5 to 166 (162 residues), 137.1 bits, E=6e-44
• TIGR00032: argininosuccinate synthase
  • amino acids 5 to 393 (389 residues), 319.7 bits, E=1.8e-99
• PF20979: Arginosuc_syn_C
  • amino acids 176 to 389 (214 residues), 177.3 bits, E=3.6e-56

Best Hits

Swiss-Prot: 37% identical to ASSY_METKA: Argininosuccinate synthase (argG) from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 86% identity to kko:Kkor_0544)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (8/10 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• canavanine biosynthesis (2/4 steps found)
• urea cycle (2/5 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine biosynthesis IV (archaea) (3/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Protein Sequence (403 amino acids)

>B158DRAFT_1976 argininosuccinate synthase (EC 6.3.4.5) (Kangiella aquimarina DSM 16071)
MSQKKVVLAFSGGLDTSFCVPYLMDKGYEVHTLFVNTGGVGDDKCLHIKERALQLGAKQH
WQVDAQQMLWNEIVTPLVWGNSKYQGQYPLLCADRYLIVRESIKLCQQLGTNAVAHGCTG
MGNDQVRFDISIKALGDYKILSPIRDIQQQVKDVRQYEIEYLMQKGFETSLEHKKYSINE
NLLGVTISGSEIDQWQEPQDDTYFLTNHYQDFPKEPLKLTIEFKQGEAVAINGEFKTGVE
IMQSLNQKLGEYGVGRGIYTGDTVIGLKGRIVFEAPALFGLLKAHQALEEVVLTQQQNQF
KPVVSDKWTELVYKGFYFDPLCQGLHQFLASTQQYVNGTVELLVYSGQLQIIAINSPSLL
VSKEASYAQTASWGIEQAEGFIKLFSHSTATWAQVNLQGGSNE