Protein Info for B158DRAFT_1952 in Kangiella aquimarina DSM 16071

Annotation: RNA chaperone Hfq

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02383: RNA chaperone Hfq
  • amino acids 5 to 64 (60 residues), 96.4 bits, E=3.3e-32
• PF17209: Hfq
  • amino acids 7 to 68 (62 residues), 98.9 bits, E=4.9e-33

Best Hits

Swiss-Prot: 74% identical to HFQ_KLEP3: RNA-binding protein Hfq (hfq) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03666, host factor-I protein (inferred from 98% identity to kko:Kkor_0518)

Predicted SEED Role

"RNA-binding protein Hfq" in subsystem Hfl operon or Polyadenylation bacterial

Protein Sequence (115 amino acids)

>B158DRAFT_1952 RNA chaperone Hfq (Kangiella aquimarina DSM 16071)
MSKGQSLQDPFLNALRREKVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAVS
TVVPIRNVRGHYGQNGDNGNGGPGNDHNMGPQGGGMGPGPMTGGGGYGSGPMGGM