Protein Info for B158DRAFT_1933 in Kangiella aquimarina DSM 16071

Annotation: Outer membrane receptor for Fe3+-dicitrate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 740 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07715: Plug" amino acids 47 to 157 (111 residues), 64.4 bits, see alignment E=1.3e-21 PF00593: TonB_dep_Rec" amino acids 267 to 710 (444 residues), 133 bits, see alignment E=2.9e-42

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 94% identity to kko:Kkor_0498)

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (740 amino acids)

>B158DRAFT_1933 Outer membrane receptor for Fe3+-dicitrate (Kangiella aquimarina DSM 16071)
MRPRFTICALAVAMTAALSAPQSALADDVKKGDEVQTIKIIGDNNAAQKVPGSAHVVSET
ELEEFKYTDVNRALQQIPGVYIQLEDGLGLRPNIGIRGTGTGRSGRITLMEDGVLIAPAP
YSASSAYYFPTFDRITGIEVLKGPAAIKYGPFTVGGAVNLISRQIPVDAQGQLKLELGEN
NERRAYAYYGDSSDNFGYLIEANKHVTDGFKMIDRHGDETGFDKDDYVAKFRFNSDYSAD
VYQQLDIKIQHSTEDSDQSYLGLTDADFAADPYRMYGVSALDTFAGEHDQYVLSYYADLT
DSFDLRVTAYRNETARNWYKTGAFIMEDPLNPGTTTRYSWSSIINTINSGGTNAAYFQSI
LDGVDAPNDRIEITDNNRNYLSEGIQASFEWDFTVGEAQHDLQLGLRVHEDEEDRFQRNS
YFIQQGGTLVFDQADAWGTAGNRVSSAEANSYYLVDTITYGDWIFTPGVRYEDVDLKRED
WANATDRSAAPSVRTNSASEVLPGFGALWLLSDNTSLLFGVNKGFAPPGNSSTDKPEESW
NYEMGVRFAGESYNSELIAFYSDYDNLLGECTLSNSGCSIDEIGDRFNGGAAEVKGIELR
VVGEFTENWLGSFSYTYTDTEFASNFDSNVWGPVETGQPIPYIPENQMQLSVGYDNSVWN
IFTNLNYVDGTCTKPACGAFQQTEDRLIVDLASEFDINESTSIYATIDNLFDDDSIVARE
PYGARPDKPRTARVGVKFNF