Protein Info for B158DRAFT_1931 in Kangiella aquimarina DSM 16071

Annotation: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details PF02518: HATPase_c" amino acids 297 to 402 (106 residues), 41.8 bits, see alignment E=6.8e-15

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 81% identity to kko:Kkor_0496)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>B158DRAFT_1931 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. (Kangiella aquimarina DSM 16071)
MATSSFNQPILIPLSWARGVALFLQVLYLFWLQQLPSPVIWVILSAQAAILLHTLVVSRT
SVSEQAIFIALIFDALLLIAYVYLTGGIANPLISLLLLPVATASLMLRPRYALSLLLIAI
AGYSLLMSLVSEHQAHQSFNSHLVGMWLVFIASAVLLYYLVVRLVAATRAQQQELEHQKQ
RQLRDDYLLALGVSAADAAHQLNTPLSSMAVLLDDMPDSSDKKMIEQQISRCQDITRNIQ
QQFEQLKQRQYQTLSVGDLFCQVTSSFRLLHPEVSLELDTQADSSSQYQLNSHLGFISAL
LNIMDNAAKASQLNQQSRIRLSCEIDKEHTGQPSLILRVFDFGDGLAEQQLESYGYVPNF
NSQQGMGTGSLISSASIELMNGTIEIANHAKGAVVTVSLPIQLQASAGNGQ