Protein Info for B158DRAFT_1922 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized protein involved in outer membrane biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 transmembrane" amino acids 8 to 30 (23 residues), see Phobius details PF05170: AsmA" amino acids 1 to 305 (305 residues), 99.4 bits, see alignment E=2.6e-32 amino acids 252 to 503 (252 residues), 95.9 bits, see alignment E=2.9e-31 PF13502: AsmA_2" amino acids 355 to 568 (214 residues), 71.1 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: K07289, AsmA protein (inferred from 82% identity to kko:Kkor_0487)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (615 amino acids)

>B158DRAFT_1922 Uncharacterized protein involved in outer membrane biogenesis (Kangiella aquimarina DSM 16071)
MKTLFKWSLRLIIAIVALFIVAAVALIIFFNSDQLKTTLTNQVKEKTGAELVIEQDLSLS
FFPWLAIETGGITLSQPPGFTQDKPALEIGAVSASIKLLPLISGDIEVGAVSLTDATLNM
TKGPQGKSNLQAFTEALQKKSEADTAQGTSTTKEALELSLQKLELTNFTVNQFDAKNTLS
QSFTLEQLMVEDFNPGEFRPVLASGRIAGEANKPDMKWALAGDLKVSKDFKQIDLQKMDA
SVDNVSATIQSIALTGVLSVAQGDSTLIEHKGTAALDGQKIQLNASAGLGKVNDIKVSLS
ADSLTLDQFMATSSKKEVEAKPTADLSPIADFLKQSRIQGDLTIGSLNLKNSKFTDVTAK
LFNKGATLHLDPFKAKAFQGELATTASVDFASKPLALAVQPDLNNIQIGDLLAAFFDFER
LSGLGALDLDMKTKGSDAKQMLQNLNGTGHINLSDGALMGIDIEKLIASGLSLQSLNQEA
YSGKTVFAGMKGDLKANNGVIDLSNFAINSPVFDLVGKATTDANKESIGGSFQLVLKGAL
KEQVEAKYPKLKDKKLPFELKGTWAEPKANIDYEAIIKAEYQGKIDEKKEELEDKVKDEL
EDKLGDFLKKKKKDN