Protein Info for B158DRAFT_1875 in Kangiella aquimarina DSM 16071

Annotation: SSU ribosomal protein S10P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01049: ribosomal protein uS10
  • amino acids 4 to 101 (98 residues), 155.2 bits, E=2.3e-50
• PF00338: Ribosomal_S10
  • amino acids 7 to 100 (94 residues), 125.7 bits, E=3.6e-41

Best Hits

Swiss-Prot: 92% identical to RS10_PSYIN: 30S ribosomal protein S10 (rpsJ) from Psychromonas ingrahamii (strain 37)

KEGG orthology group: K02946, small subunit ribosomal protein S10 (inferred from 99% identity to kko:Kkor_0436)

MetaCyc: 89% identical to 30S ribosomal subunit protein S10 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S10p (S20e)" in subsystem Ribosome SSU bacterial

Protein Sequence (103 amino acids)

>B158DRAFT_1875 SSU ribosomal protein S10P (Kangiella aquimarina DSM 16071)
MAKQRIRIRLKAFDHKLIDQSTSEIVNTAKRTGAQVKGPIPLPTRKERFTILISPHVNKD
ARDQYEIRTHKRLVDIIEPTEKTVDALMKLDLAAGVDVQISLS