Protein Info for B158DRAFT_1872 in Kangiella aquimarina DSM 16071

Annotation: ribosomal protein S7, bacterial/organelle

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00177: Ribosomal_S7
  • amino acids 1 to 150 (150 residues), 225 bits, E=1.6e-71
• TIGR01029: ribosomal protein uS7
  • amino acids 3 to 157 (155 residues), 224.6 bits, E=2.7e-71

Best Hits

Swiss-Prot: 80% identical to RS7_ALCBS: 30S ribosomal protein S7 (rpsG) from Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)

KEGG orthology group: K02992, small subunit ribosomal protein S7 (inferred from 99% identity to kko:Kkor_0433)

MetaCyc: 72% identical to 30S ribosomal subunit protein S7 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S7p (S5e)" in subsystem Ribosome SSU bacterial

Protein Sequence (157 amino acids)

>B158DRAFT_1872 ribosomal protein S7, bacterial/organelle (Kangiella aquimarina DSM 16071)
MPRRRVVAKREILPDPKFGSELLAKFINVLMQDGKKSTAEKIVYGALDIITEKKSGEEPL
ELFEKGLDNIRPMVEVKSRRVGGSTYQVPVEVRPARQTALAMRWLTDAARKRSEKSMRER
LAGEVLDALEGRGSAVKKREDVHRMAEANKAFSHFRW