Protein Info for B158DRAFT_1871 in Kangiella aquimarina DSM 16071

Annotation: SSU ribosomal protein S12P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00981: ribosomal protein uS12
  • amino acids 1 to 123 (123 residues), 230.8 bits, E=1.4e-73
• PF00164: Ribosom_S12_S23
  • amino acids 12 to 123 (112 residues), 146.1 bits, E=1.6e-47

Best Hits

Swiss-Prot: 92% identical to RS12_HYDCU: 30S ribosomal protein S12 (rpsL) from Hydrogenovibrio crunogenus (strain XCL-2)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 99% identity to kko:Kkor_0432)

MetaCyc: 86% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Protein Sequence (124 amino acids)

>B158DRAFT_1871 SSU ribosomal protein S12P (Kangiella aquimarina DSM 16071)
MATINQLVRKPRKKQVKKTNVPALEACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNG
YEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHCVRGTLDLAGVKDRKQGRSKYGAK
RPKG