Protein Info for B158DRAFT_1868 in Kangiella aquimarina DSM 16071

Annotation: ribosomal protein L7/L12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00855: ribosomal protein bL12
  • amino acids 1 to 125 (125 residues), 163.4 bits, E=1.5e-52
• PF16320: Ribosomal_L12_N
  • amino acids 5 to 52 (48 residues), 65.6 bits, E=2.5e-22
• PF00542: Ribosomal_L12
  • amino acids 59 to 125 (67 residues), 109 bits, E=1.2e-35

Best Hits

Swiss-Prot: 78% identical to RL7_IDILO: 50S ribosomal protein L7/L12 (rplL) from Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 98% identity to kko:Kkor_0429)

MetaCyc: 69% identical to 50S ribosomal subunit protein L12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial

Protein Sequence (125 amino acids)

>B158DRAFT_1868 ribosomal protein L7/L12 (Kangiella aquimarina DSM 16071)
MALSKDDILNAIAEMSVMEVVELVEAMEEKFGVSAAAAVAVAGPAAGGDAAAAAEQTEFD
VVMKSFGGNKVAVIKAIRGITGLGLKEAKDMVEGAPVAVKEGVEKAEAEDIKKQLEEAGA
EVEIK