Protein Info for B158DRAFT_1840 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized protein involved in purine metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04356: DUF489" amino acids 8 to 196 (189 residues), 211.9 bits, see alignment E=4.6e-67

Best Hits

Swiss-Prot: 41% identical to HFLD_SHESA: High frequency lysogenization protein HflD homolog (hflD) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K07153, high frequency lysogenization protein (inferred from 94% identity to kko:Kkor_1096)

Predicted SEED Role

"FIG002903: a protein of unknown function perhaps involved in purine metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>B158DRAFT_1840 Uncharacterized protein involved in purine metabolism (Kangiella aquimarina DSM 16071)
MNQSNYPNIVLALAGICQALECVRTIARTGEADPTDVEIMLESVLKTDAEKAEDIYKNHK
YLHTGFKVLIEQLSGSRADADFGRYLVGVLNLAKRFLSDSKMKEVMASRVKQANRLHEYH
EGINHDLIEQLANIYKDTISTYSAKIQVTGNGRYLEQAANQAKIRALLLAAIRSAVLWDQ
VGGKKRQFLFSKNKILETAKAYLA