Protein Info for B158DRAFT_1820 in Kangiella aquimarina DSM 16071

Annotation: periplasmic chaperone LolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR00547: outer membrane lipoprotein carrier protein LolA" amino acids 13 to 214 (202 residues), 87.1 bits, see alignment E=5.5e-29 PF03548: LolA" amino acids 40 to 202 (163 residues), 135.3 bits, see alignment E=8.7e-44

Best Hits

Swiss-Prot: 35% identical to LOLA_HAHCH: Outer-membrane lipoprotein carrier protein (lolA) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 79% identity to kko:Kkor_1120)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>B158DRAFT_1820 periplasmic chaperone LolA (Kangiella aquimarina DSM 16071)
MIKSIKKQFGQLTAAVALMGLSIAAQADAPQELEKKLTAIDSFKADFSQVITDEFGTLID
KSSGHFELKRPQLFRWVVVEPFEQQIVADGINLWQFDMDIEQINVSSLDQTLANSPAALL
SQAQLDVAANYEVAAVKGEGEGVLIYHLTPRDPDALYEVLILEFHGSDLVALQVKDNLGQ
ATLVDFTNVTMNPEFEDDHFEFEVPEGIDVIDSRNSIEGAALEKGDF