Protein Info for B158DRAFT_1818 in Kangiella aquimarina DSM 16071

Annotation: protein CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details TIGR00494: protein CrcB" amino acids 8 to 121 (114 residues), 90.7 bits, see alignment E=4.2e-30 PF02537: CRCB" amino acids 9 to 118 (110 residues), 96.7 bits, see alignment E=4.8e-32

Best Hits

Swiss-Prot: 47% identical to CRCB_SHEWM: Putative fluoride ion transporter CrcB (crcB) from Shewanella woodyi (strain ATCC 51908 / MS32)

KEGG orthology group: K06199, CrcB protein (inferred from 92% identity to kko:Kkor_1122)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>B158DRAFT_1818 protein CrcB (Kangiella aquimarina DSM 16071)
MNIAVIASIGLGGALGAIARFKCRDLAEWLFGEHYLWGTLLANVIGCFIAGFLLTFWQTA
QVSNNIRMGVVIGFLGALTTFSTFSVETFQLMQQQLWLKAGLNISANLILCMLFVFFGAW
LGGRMAA