Protein Info for B158DRAFT_1809 in Kangiella aquimarina DSM 16071

Annotation: S-adenosylmethionine decarboxylase proenzyme, Bacillus form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03330: S-adenosylmethionine decarboxylase proenzyme
  • amino acids 46 to 153 (108 residues), 134.5 bits, E=1e-43
• PF02675: AdoMet_dc
  • amino acids 49 to 153 (105 residues), 124.8 bits, E=9.2e-41

Best Hits

KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 99% identity to kko:Kkor_1130)

Predicted SEED Role

"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1B" in subsystem Polyamine Metabolism (EC 4.1.1.50)

MetaCyc Pathways

• spermidine biosynthesis I (2/2 steps found)
• aminopropylcadaverine biosynthesis (2/3 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• spermine biosynthesis (1/2 steps found)
• superpathway of polyamine biosynthesis II (5/8 steps found)
• spermidine biosynthesis III (2/4 steps found)
• superpathway of polyamine biosynthesis I (4/8 steps found)
• L-methionine salvage cycle III (4/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (3/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.50

Protein Sequence (157 amino acids)

>B158DRAFT_1809 S-adenosylmethionine decarboxylase proenzyme, Bacillus form (Kangiella aquimarina DSM 16071)
MYKDFDYNQEIDPTGATETQWPSFKNVNENDERNDHFIHRNGKIFAGTHLIIDLWGASKL
DNLQLMEQAFRESVVECGATLLHIHMHHFTPNGGISGVAVLAESHISVHTWPERDYAAFD
VFMCGDAEPHKAVEILRKAFLPSKIEVSEILRGQVEK