Protein Info for B158DRAFT_1808 in Kangiella aquimarina DSM 16071

Annotation: Predicted permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details PF00892: EamA" amino acids 8 to 137 (130 residues), 54.1 bits, see alignment E=9.8e-19 amino acids 148 to 274 (127 residues), 57.5 bits, see alignment E=8.4e-20

Best Hits

KEGG orthology group: None (inferred from 90% identity to kko:Kkor_1131)

Predicted SEED Role

"putative permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>B158DRAFT_1808 Predicted permease, DMT superfamily (Kangiella aquimarina DSM 16071)
MNTGFWRLILLAVFAVFLMAMVPVIIKYIAVDPWLIGAFRLAVSVVGLILLAGITRRPLI
ARKENWIFILLLGLVFAIHWLTYFYSIQLSTASIAAIGVSTFGAHLLLLGWFVHRQPPHW
LELFCVLLAFVGVYLVVPDFNLADGMTIGLILAVISGFLYALLPLMHQKYRHINGERRTF
GQFFVAMVIFSFGLPQADWEIPSESWLGLIVLGVVCTLVAHSLWIKVSTELNHVVTSVVY
YLYVPIAMLFSFVFLDELLSPVQLLGAGLILFANILGIWFRWRRRDEEEN