Protein Info for B158DRAFT_1802 in Kangiella aquimarina DSM 16071

Annotation: Saccharopine dehydrogenase and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF01488: Shikimate_DH" amino acids 2 to 73 (72 residues), 24.5 bits, see alignment E=5.2e-09 PF03435: Sacchrp_dh_NADP" amino acids 4 to 117 (114 residues), 57.2 bits, see alignment E=4.7e-19 PF16653: Sacchrp_dh_C" amino acids 121 to 367 (247 residues), 156 bits, see alignment E=4.2e-49

Best Hits

KEGG orthology group: None (inferred from 92% identity to kko:Kkor_1137)

Predicted SEED Role

"Carboxynorspermidine dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>B158DRAFT_1802 Saccharopine dehydrogenase and related proteins (Kangiella aquimarina DSM 16071)
MSNILVIGGGMVGSVIARDLSEKYDVTVADVSNTRLKLLKKRHPSFSTLELDVLNLDELK
SAVAPFDIIVCGVPGHLGFKALKNIIEAGKDVVDISFSPENCLELDYLAKKHKVTAVIDA
GVAPGMDNLLLGFHNTRMEVSHFECLVGGLPKIRKKPFEYKAAFSPIDVIEEYTRAARFF
EHGRMVTREALSDRELVEFDKIGTLEAFNTDGLRSLMFTMNNVPNMKEKTLRYPGHVEAI
RTLKASGFFSKDKVSVRGLEISPLEVTSEILINEWKLKPKEEEFTIMRVTIRGLEGEKNK
EYIYTMYDEYDKVKHETSMARTTGFTANAVCQLLLKGKFDKKGVFAPEHIGGHTDCCKTV
LDYLEERKVRYRLEETVLST