Protein Info for B158DRAFT_1797 in Kangiella aquimarina DSM 16071

Annotation: sodium/proton antiporter, CPA1 family (TC 2.A.36)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 184 to 207 (24 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 241 to 258 (18 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 362 to 386 (25 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 11 to 384 (374 residues), 144 bits, see alignment E=6e-46 PF02254: TrkA_N" amino acids 399 to 501 (103 residues), 26.9 bits, see alignment E=5.3e-10

Best Hits

KEGG orthology group: None (inferred from 94% identity to kko:Kkor_1143)

Predicted SEED Role

"sodium/hydrogen exchanger"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (623 amino acids)

>B158DRAFT_1797 sodium/proton antiporter, CPA1 family (TC 2.A.36) (Kangiella aquimarina DSM 16071)
MTPDLALTLSAVLAIGIGAQWLAWYLKQPSILFLLLIGIIIGPVLGWFNPDQAMGDLLFP
FISLGVAVILFEGSLTLEFHEVKSHGRVVQMLVSVGVLITIAIAGAAAYFLFDMHPLIAL
LFGALVCVTGPTVIIPILRNLRANRNISNVLRWEGIIIDPIGAIAVVLVYEYIISGGSGE
NALLLFGKILLVGAVLGLAGAALLATLLKKHWVPEYLRNIFTLAFVLLVFSVSNHIEHES
GLLTVTILGVALANWPKFPKDDILDFKESLSILLISVLFIVLAARLDLASVEQIGYTSLI
LLAIIMFVARPLGVWVSSIGSKLKTNEKLMISWIGPRGIVAAAISSLFAIRLEEFGLAGT
EFLVPLVFIIIIGTVLTQSLTAAFVGNLLGVREPSNNGVLIIGSNPVALTVAKALKDHNV
DVLMAHNNYSNIAKARMEGIRVYFGNPISEHADRNLDLIGFGHVFAMSMDQELNSLSELN
FRHTFGKQNIYRLRSAKDKNKNNRQEKDEYYQSPWLFGESVTYGQLASMIAKNAKIKVTN
ITESYNFEQYQNDNPNYVALFMIDKNETMKVFSSETEGKNIKEGTKIISMIMDSEDPKGE
RPTPSGEQKEQFQKLAQKEKGMS