Protein Info for B158DRAFT_1795 in Kangiella aquimarina DSM 16071

Annotation: Ion transport protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 200 to 213 (14 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details PF00520: Ion_trans" amino acids 44 to 264 (221 residues), 169.7 bits, see alignment E=6.5e-54 PF08016: PKD_channel" amino acids 138 to 260 (123 residues), 37.2 bits, see alignment E=2.3e-13

Best Hits

KEGG orthology group: K08714, voltage-gated sodium channel (inferred from 89% identity to kko:Kkor_1145)

Predicted SEED Role

"Ion transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>B158DRAFT_1795 Ion transport protein. (Kangiella aquimarina DSM 16071)
MCGKLSLHFSRCLNPYLLVISPVSHDSKKKTKTMHARVIALVHNKWFERFIISVIVLSGI
LIGLETSRALSQTHVSWIETAHAVILGIFVIEVVLKLYACAPDIKKYFKDGWNVFDFSIV
VVALIPMTGQFAVIGRLLRLLRVARLISVLPELRLIVSTLIKTIPSMFHVVVLMLVLFYI
YAVAGFNLFHETNPQFWGDLGTSMLTLFRIVTLEGWTQVMYLDLANHTWAWMFYVSFIVI
GTFIIINLFIALVLNNLDEVKEQKKAMERSQKTEAHILNNIVLIRKQLQEIEKEMHEKQ