Protein Info for B158DRAFT_1784 in Kangiella aquimarina DSM 16071

Annotation: nicotinamide mononucleotide transporter PnuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 62 to 62 (1 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 153 to 168 (16 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details PF04973: NMN_transporter" amino acids 17 to 195 (179 residues), 167.8 bits, see alignment E=1.2e-53 TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 26 to 196 (171 residues), 67.7 bits, see alignment E=6.3e-23

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 89% identity to kko:Kkor_1156)

Predicted SEED Role

"Predicted thiamin transporter PnuT" in subsystem PnuC-like transporters or Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>B158DRAFT_1784 nicotinamide mononucleotide transporter PnuC (Kangiella aquimarina DSM 16071)
MSDFFETFSQQVAATSGWEWLAVALAIAYILLAIKENIWCWVAAFFSTAIYTVLFYDVNL
FMESLLNVYYLLMAVYGFYQWRFTGKRGNEKPISRWSLKVHLAWIVGLSAVVVISGYLLD
NYTTQDFAYVDSFTTWFAVFTTYLLAQKVLENWLYWVVIDFVSVFLYWEKGLLITAILFM
AYTVMAIVGWLQWKKHYAQQKTA