Protein Info for B158DRAFT_1776 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized protein involved in cysteine biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 219 to 245 (27 residues), see Phobius details PF07264: EI24" amino acids 11 to 239 (229 residues), 186.8 bits, see alignment E=2.4e-59

Best Hits

Swiss-Prot: 45% identical to CYSZ_ECO24: Sulfate transporter CysZ (cysZ) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K06203, CysZ protein (inferred from 92% identity to kko:Kkor_1164)

MetaCyc: 45% identical to sulfate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-586

Predicted SEED Role

"Sulfate transporter, CysZ-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>B158DRAFT_1776 Uncharacterized protein involved in cysteine biosynthesis (Kangiella aquimarina DSM 16071)
MAQNTFHGAHYLADGFRMLTQKGIKRYVLIPLVINLILLSIALILLVSQVSSWSQWVEQT
ISSWGAWEWLGTALAWLMWPVVILGGILFVFFFFAMLANWIAAPFNGLLAEAVENKLHAA
AGYDEKVLPDQGFWALVKDIPRLFGREWTKLKYYIPRALICLLIFFIPLIGALAFPILWF
IFNAWMMSVQYVDYPMDNHKVPFQEMLKALQQRRGGTFGFGAMVMLMTMIPFINLLVMPA
AVCGATKMWYEHYRKDMLGSQTVKQNQ