Protein Info for B158DRAFT_1755 in Kangiella aquimarina DSM 16071

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 3 to 320 (318 residues), 462.9 bits, see alignment E=2.5e-143 PF00108: Thiolase_N" amino acids 36 to 146 (111 residues), 41.7 bits, see alignment E=1.4e-14 PF08545: ACP_syn_III" amino acids 107 to 184 (78 residues), 110.7 bits, see alignment E=3.8e-36 PF08541: ACP_syn_III_C" amino acids 231 to 320 (90 residues), 132.2 bits, see alignment E=9.4e-43

Best Hits

Swiss-Prot: 60% identical to FABH_XANCP: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 97% identity to kko:Kkor_1186)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>B158DRAFT_1755 3-oxoacyl-(acyl-carrier-protein) synthase III (Kangiella aquimarina DSM 16071)
MKYSKILGMGSYLPEKVLTNADLEKMVDTTDKWITERTGIKKRHIAADDQSASDLGFEAA
KKAIENSGIDASEIDMIVVGTATPDKMFPSVACYIGHALGIGGVPAFDITTACPGFVYGL
SIADQFIKTGHRKNVLVVGTEVLSRLVNWDDRSTCVIFGDGAGAAVVTGSDEPGILSTHI
HADGGYGDLLYCNNGLRGQLGEFPEPQIVMRGNEVFKVAVKTLSQIVDETLEANNMQKED
IDWLIPHQANIRIIQATAKKLGASMDKVVVAVDRHGNTSSASIPLAMCEAIEDGRIKRGD
VCLLESFGGGFTWGSALIRY