Protein Info for B158DRAFT_1737 in Kangiella aquimarina DSM 16071

Annotation: two component transcriptional regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 97.2 bits, see alignment E=1e-31 PF00196: GerE" amino acids 150 to 205 (56 residues), 66.8 bits, see alignment E=1.5e-22 PF08281: Sigma70_r4_2" amino acids 151 to 193 (43 residues), 32 bits, see alignment 1.1e-11

Best Hits

Swiss-Prot: 39% identical to NREC_STAES: Oxygen regulatory protein NreC (nreC) from Staphylococcus epidermidis (strain ATCC 12228)

KEGG orthology group: None (inferred from 98% identity to kko:Kkor_1204)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>B158DRAFT_1737 two component transcriptional regulator, LuxR family (Kangiella aquimarina DSM 16071)
MIRVMLADDHTILRQGLVSLLSKDADCTVVAEASNGLEAVEKAFETRPQVAVIDISMPEL
NGMEVVKRIHDKLPECKILVLTMHEEQEYVIHMVRAGASGYLLKDSASEELIDAVKALAS
GKTYYSQYAASVLATQYSQPDQEWQDPYKNLTQREREVFHLVVDGKTTKDIARALDISVK
TAENHRGKVLEKLGVSNTAELVRYAAKHNLLV