Protein Info for B158DRAFT_1703 in Kangiella aquimarina DSM 16071

Annotation: TIGR03440 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 18 to 442 (425 residues), 517.3 bits, see alignment E=2e-159 PF12867: DinB_2" amino acids 25 to 158 (134 residues), 33.8 bits, see alignment E=4.4e-12 PF03781: FGE-sulfatase" amino acids 220 to 335 (116 residues), 63.9 bits, see alignment E=1.9e-21 amino acids 366 to 443 (78 residues), 42.1 bits, see alignment E=8.5e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to kko:Kkor_1233)

Predicted SEED Role

"protein of unknown function DUF323"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>B158DRAFT_1703 TIGR03440 family protein (Kangiella aquimarina DSM 16071)
MLDQTKPVGLSDNLEQVLEDFVDVRTFSEKLCEPLKPEDYNLQAIAETSPAKWHLAHTSW
FFETFILKKFLPDYTCFNSQFEYLFNSYYNAIGEQYPRPQRGLLSKPDVKVVYRYRQFIT
EQIKQLVSDLVEANSNNLNDVLSLLRLGINHEQQHQELLLTDIKYNLFQNPLHPAYRDSE
DSLPQYSPKEPSLESIKWITFDEKLVSIGVNQTDAPISQSDFVYDNETPRHKFYRHSFEV
ANRLITNGEYLEFIEHGGYSDPQYWLSDGWDAVRNHQWQAPLYWFKKDGNWFIYTLNGVQ
PLPLNQPLSHVSYYEADAFARWSGARLLTEQEWESIAISNTPETAMNNFVEDNVLHPVPA
ADNEQLQQLFGDVWEWTSSSYSAYPGFKPAAGAVGEYNGKFMCNQYVLRGGSCVTSRSHI
RKTYRNFFYPDARWQFSGIRLARDH