Protein Info for B158DRAFT_1698 in Kangiella aquimarina DSM 16071

Annotation: Putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 205 (189 residues), 105.2 bits, see alignment E=1.6e-34

Best Hits

KEGG orthology group: None (inferred from 89% identity to kko:Kkor_1249)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>B158DRAFT_1698 Putative threonine efflux protein (Kangiella aquimarina DSM 16071)
MLDTTLILLFIPTFLLISATPGMCMTLALTLGMSIGVRRTMYMMWGELIGVALVSVLAVV
GVATIMLNYPAAFLVLKYGGGAYLIYLGIQMWRSRGKMAIDLSNNQPQTVSGKQLATQGF
ITAIANPKGWAFTVSLLPSFINPDMPMPPQLAALVVIILLSEFTFLMLYATGGKTLRRIL
QRSDNVRIINRLSGTLMIAVGIWLAFG