Protein Info for B158DRAFT_1663 in Kangiella aquimarina DSM 16071

Annotation: heavy metal response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR01387: heavy metal response regulator" amino acids 3 to 221 (219 residues), 341.6 bits, see alignment E=9.5e-107 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 89.3 bits, see alignment E=1.9e-29 PF00486: Trans_reg_C" amino acids 146 to 221 (76 residues), 91.8 bits, see alignment E=2.4e-30

Best Hits

Swiss-Prot: 64% identical to CUSR_ECOLI: Transcriptional regulatory protein CusR (cusR) from Escherichia coli (strain K12)

KEGG orthology group: K07665, two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR (inferred from 87% identity to sde:Sde_1948)

Predicted SEED Role

"DNA-binding heavy metal response regulator" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>B158DRAFT_1663 heavy metal response regulator (Kangiella aquimarina DSM 16071)
MRLLLVEDEVKTGDYLKQGLTEAGFMVTLTRNGLDGHHLAITETFDLMVLDVMLPDVDGW
RIVQSIREAGCQTPVLFLTARDSVDDRVKGLELGADDYMVKPFAFAELLARVRTLLRRST
TQLMTDQIRIADLILDLPRHRAMRAGRKINLSHKEFCLLELLVRRQGEVLPRTLIASQVW
DMNFDSDTNVIDVAIRRLRAKIDDDFETKLIHTVRGMGYKLDLDDEYEE