Protein Info for B158DRAFT_1631 in Kangiella aquimarina DSM 16071

Annotation: Co/Zn/Cd efflux system component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 127 to 146 (20 residues), see Phobius details amino acids 158 to 174 (17 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details PF01545: Cation_efflux" amino acids 128 to 297 (170 residues), 66.9 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: None (inferred from 97% identity to kko:Kkor_1266)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>B158DRAFT_1631 Co/Zn/Cd efflux system component (Kangiella aquimarina DSM 16071)
MSQKCNRDCKADATDETQDITNDDKLFEGAHVSEYHVPKMDCPSEEGMIRMALDSLEPSV
ILEFDTHKRIVRVFHHLELRDMVEDRITSLGLGARLESTNAVDSEIIHKARLTAQNEEAE
EAGILKMLLAINAVMFITELVIGWWAQSTGLIADSLDMFADAAVYGVALYAVGHGVRKKL
RAAHISGWLQIILALGVLTEVVRRLVQGSEPESNLMMVFGLIALVANVWCLILIAKKRNG
GAHMRASWIFSANDVIANLGVIIAGGLVAWTGSQYPDLIIGFIIGSIVLTGGFRILKIKS