Protein Info for B158DRAFT_1628 in Kangiella aquimarina DSM 16071

Annotation: mercuric reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00403: HMA
  • amino acids 4 to 63 (60 residues), 47.6 bits, 7.1e-16
• PF07992: Pyr_redox_2
  • amino acids 84 to 402 (319 residues), 215.5 bits, E=4.5e-67
• TIGR02053: mercury(II) reductase
  • amino acids 84 to 545 (462 residues), 557.7 bits, E=1.2e-171
• PF12831: FAD_oxidored
  • amino acids 85 to 131 (47 residues), 32.1 bits, 3.2e-11
• PF13738: Pyr_redox_3
  • amino acids 213 to 386 (174 residues), 39.3 bits, E=1.9e-13
• PF00070: Pyr_redox
  • amino acids 256 to 326 (71 residues), 48.2 bits, E=5.3e-16
• PF02852: Pyr_redox_dim
  • amino acids 421 to 527 (107 residues), 103.3 bits, E=3.5e-33

Best Hits

Swiss-Prot: 65% identical to MERA_SHEPU: Mercuric reductase (merA) from Shewanella putrefaciens

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 98% identity to kko:Kkor_1269)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• phenylmercury acetate degradation (1/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.16.1.1 or 1.8.1.4

Protein Sequence (545 amino acids)

>B158DRAFT_1628 mercuric reductase (Kangiella aquimarina DSM 16071)
MRKFSISGMTCERCPQQIEDALIVMPGVRNATVFYTKSSAVVEAESDVNEQTLINTIKAL
GYTAQPVALDGCDSEDVTDKKSLHVAIIGTGSAAFACAIKAVENGAQVTLVEAGDVIGGC
CVNVGCVPSKILLRAAQLAEQQRNNPFDGLENHEPSLDRSLLAKQQTARVEELRAAKYQH
ILDTNPALSLVQGYASFKDTHTLTIRNKDGYEQELVADRFLIASGSQPSIPPIPGLVDTP
YWTSTEALFETELPEHLLVIGSSVVAVELAQAYRRLGAEVTILARSTLLLREDPLLGEGL
TVAFEQEGIRVLEHTQASQVSYEDNKFILDTEQGEIRGDKLLVATGRAPNTANLNLGVAG
VETEANGAVAVDNQMRTSQPHVYAAGDCSNMPQLVYVAAAAGSRAGINMTGGEAQLDLST
MPAVIFTEPQVATVGLSEQEAHAQNIETESRVLPLENVPRALANFDSQGFIKLVVEAGSQ
RLIGAQVLAHDGGEIIQSAALAIHNHMTVDDLADQLFPYLTMVEGLKLCAQTFSKDIKEL
SCCAG