Protein Info for B158DRAFT_1618 in Kangiella aquimarina DSM 16071

Annotation: sodium/proton antiporter, NhaD family (TC 2.A.62)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 54 (18 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 140 to 156 (17 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 187 to 200 (14 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details amino acids 406 to 431 (26 residues), see Phobius details amino acids 446 to 464 (19 residues), see Phobius details PF03600: CitMHS" amino acids 51 to 414 (364 residues), 134.3 bits, see alignment E=2.9e-43

Best Hits

Swiss-Prot: 59% identical to NHAD_HALED: Na(+)/H(+) antiporter NhaD (nhaD) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: None (inferred from 91% identity to kko:Kkor_1351)

Predicted SEED Role

"Na+/H+ antiporter NhaD type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>B158DRAFT_1618 sodium/proton antiporter, NhaD family (TC 2.A.62) (Kangiella aquimarina DSM 16071)
MKKHSYFLFLALLLFPFQLLAADTSTSTLLDLTGHWVGFLAIAIFVLAYSLVIFEEKIHL
RKSKPILVAAGLIWLVIGIVYHQHGMSQLAEEAVRHNFLEYAELFFFLLVAMTYINAMIE
RDVFDALRDWLVNKGFSYKQLFWMTGILAFFISPIADNLTTALIMCSVVLAVGNGHAKFI
GLSCINIVVAANAGGAFSPFGDITTLMVWQKGMVEFSEFFALFIPSLVNFLVPAIIMQFA
IMNGKPKPIEEGSHAQIKQGGLIIVGLFLLTIITAVSFHNFLHLPPAIGMMLGLGFLKFY
GFFLRKQHKKETEENPTSVSTKRPYDIFDRIAQAEWDTLFFFYGVILAVGGLGFLGYLGM
ASSYMYGELGATPANILVGILSSIVDNIPVMFAVLTMQPDMSHAQWLLVTLTAGVGGSLL
SVGSAAGIALMGQARGHYTFMTHLKWTPVIALGYAASIWVHTLINGF