Protein Info for B158DRAFT_1608 in Kangiella aquimarina DSM 16071

Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF13793: Pribosyltran_N" amino acids 5 to 115 (111 residues), 65.8 bits, see alignment E=5e-22 TIGR01251: ribose-phosphate diphosphokinase" amino acids 6 to 288 (283 residues), 185.1 bits, see alignment E=7.7e-59 PF00156: Pribosyltran" amino acids 151 to 276 (126 residues), 67.2 bits, see alignment E=1.7e-22 PF14572: Pribosyl_synth" amino acids 209 to 280 (72 residues), 37.2 bits, see alignment E=4.5e-13

Best Hits

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 84% identity to kko:Kkor_1365)

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.1

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>B158DRAFT_1608 ribose-phosphate pyrophosphokinase (Kangiella aquimarina DSM 16071)
MSTLLFDLSDNLNLSAPVCEKIGATMGKLSMHYFPDGEVNIQLHSPCKGKTIVVLADLSH
PNAKILPLLFVLRMIREHEPEKVVLISPYLPYMRQDAVFHEGESILARHFAEILSENIDA
LITVDPHLHRFFSLDQVYPIRTYLAHTSGPIAQWIKAHISNPLIIGPDSESRQWVEAIAS
EIQVPFLVANKVRHGDKDVEISIKGIEEHTDKTIVLVDDIISTGHTILEITKHLEDAGMN
NITCIASHAIFNENAYGMLAQSHISQIVTCNTIPHVSNAIDVSGSIAESYKLVK